Counting matching models…
These are class specific spell slot trackers and Dice vaults for Dungeons and Dragons 5e. Two versions are currently available Standard Caster, and Warlock. Both feature tokens for tracking spell slot usage, space for storing dice, and a…
For optimal strength print with bottom of hanger against print bed. No supports required.
Created with Tinkercad Revolve tool for the curve and Sketch tool for the profile, a simple mount that holds the phone against the back of the monitor and it is just right to do meetings with. A simple 30 minute design, 90 minute print.…
This is a very specific fix for a very specific problem that you don't likely have.
This is a very specific fix for a very specific problem that you don't likely have.
We love our Enso silicon rings ( ensorings.com ). We...have a few. So I made these boxes to hold them. The rings come in different widths; my wife likes the thinner ones, hence "ring box, women's". That one holds 26 rings, while the other…
Disclaimer: I had never used SolidWorks until a week ago, this fits my use-case currently - if you need to make adjustments feel free to improve on the design and tag me. Description: This is a microphone holder adapter for the…
Helps children change gear easier. Secured with three stainless steel M3 bolts and heat set threaded inserts. Feel free to use the included FreeCad model to change to any other type of fastenings. Printed with the "lid" flipped with the…
Adaptive pedal for Kinder King Kids Tricycle (Amazon link below) Designed for a tool-free perfect fit. Pedal and top bracket will need to be mirrored in slicer. Two adapters are required for each side. One adapter goes on upside down, one…
Created with Tinkercad Revolve tool for the curve and Sketch tool for the profile, a simple mount that holds the phone against the back of the monitor and it is just right to do meetings with. A simple 30 minute design, 90 minute print.…
This is a remix of https://www.thingiverse.com/thing:2812350 (Mean Well LRS-350 version) with a few small modifications: The entire mount is shifted one millimeter in the positive X direction (based on a source comment) The vent side wall…
update!!!!! after a few days, i hate it, the design is awful, and honestly i will just not deleted it because, i think even a mistake is a learned experience, and someone might find some use on it. but do not use this design as it is, if…
A copy of a specific basketball pole connector. Allows to easily extend the pole's height. The poles are hollow, and connect from both sides.
It´s a model of hexagon parts wich build a stand for pens and crayons. You can fit there USB or SD-cards as well. Enjoy & leave a like :)
Following the recent actions undertaken by NTI Group, I have “designed” a new benchmark, truly open to the community to do with as they wish. May NTI Group gaze upon it and despair. This page previously falsely attributed blame to…
Love the existing design of the analog module case because I also use the digital patch antenna. The model is awesome but had some fitment issues with my SpeedyBee analog receiver. I ended up just making some slight adjustments to better…
I got a cheap mini butane blow torch off Amazon that is pretty great in every way, except the base is narrow, so it has a tendency to tip over. I've mitigated this by making a flanged base that screws onto the knurling of the grip. I've…
Attach using e.g. 40x40mm 3M VHB pad. One at the top is enough, even though two fits. I printed mine in ABS and it has been up for several months. The shelf direction is intentional for ergonomic grip, even though it would have been…
Multimaterial - MMU 3 Multicolor Print-MK3.5S with multi colored segmenter-r3 This is a Remix / Revisitation of the original .gcodes of MMU3 Multi Material Unit. These .gcode are specific for printing by MK3.5S, and are provided by…
Store, Carry, Display and Roll your dice in style with this STL file for our Dice Vault! This model allows storage of up to 3 full dice sets, and when opened includes a handy tray for rolling your Crits (or fails). The model contains…
Birdhouse holes. Screw to the front of your birdhouse to invite or exclude specific birds. 1" for Wrens, 1.125" for Chickadee, 1.25" for Nuthatch and 1.5" for the Eastern Nuthatch. All have the same mounting pattern so if you want a…
Please use STEW675 holder https://www.printables.com/model/1253290-modified-for-attach-the-head-front-cover-with-the
Game cartridge for NES FAMICOM DENDY only for a specific purpose
Creality Ender 3V2 specific rear feet to allow for the existing bolts from the PSU there are some similar ones on here, but as per design the Ender 3V2 has psu bolts that dont allow for all other designs to fit, they take a while to…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology. Protein Data Bank ID:…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains…
The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are…
Inspired by various of these, in particular I used the pictures at https://www.printables.com/model/439968-drill-guide as prompts. Uses steel rods from junked (taken apart for the bits) old HP inkjet printer. ('Dumpster dive' source. Had…
So my clumsy ass (literally) broke off the original RCA connectors. Seeing as how expensive the set was and how the entire model is discontinued, I did not want to replace the subwoofer. Instead, I created a thing to hold the cables in…
I absolutely love @George 's filament swatches, but I was tired of writing the brand name on them. I am slowly adding different brand names with the name embossed in the swatch. Also included is the rare generic few that aren't available…
This 3D-printable panel is an ideal solution for owners of older Zerowatt dishwashers, DIY repair enthusiasts, or technicians looking to extend the life of discontinued appliances. By printing this model, you can overcome the challenge of…
Since Brodit doesn't offer any other car-specific holders other than one for the left side of your steering wheel in the air vent, I decided to make a model for your center console. I recommend printing it with PETG because of the high…
I designed this specific caddy (bottle holder) for my favorite OJ which comes in a 52 fluid oz bottle. The plastic bottle was I'm sure designed with minimum wall thickness for economic reasons but when I try to do the first pour the…
Solving a very specific issue that I had. Printed in PLA, seems to hold up okay. had to print in two parts to reduce print time and waste. Super glued lid and base together. I would recommend printing as one part.
Description There are some awesome candy dispensers out there. I made this new one to save on filament (this single dispenser uses only .1 kg and the 3x dispenser uses only .22 kg), to be small, and to only dispense a small amount of…
Bring your own ATM gearbox and charging handle. T piece is printed Only tested with Chenghai SX and LDT compatibility is not guaranteed. Hardware Needed: 1x m5 rivnut for the buffer screw 6x m5 hex nuts for the handguard 2x m3 hex nuts…
è un disco con lo stesso diametro e spessore di una moneta da due euro utilizzabile per i carrelli della spesa
use 2 walls, 5-10% infill. use the speed, filament and temperature you want
Simple floor stand for guitar (acoustic guitar). It’s important to note that this stand is designed for guitars with a 10 cm base/body depth. Easy print — does not require dense infill or supports. The stand may show some instability. Due…
Hey everyone, I made this box as a birthday gift for a friend. A little summary of all the memories we shared from our childhood. As the name suggests, it is quite specific: It fits a fingerboard (100 × 34 mm or smaller), a Beyblade, and…
Obtained from the planetside subreddit (link: https://old.reddit.com/r/Planetside/comments/eizadz/tactical_superiority_3d_printed/ ). No guarantee these are printable out of the box, so double check the slicer results. Category: Vehicles
The beauty of 3d printing is creating solutions for very specific problems in your life. Sharing these designes then gets tricky, as there is probably no other person in the world with that exact problem to solve, but here I go sharing it…
The thumb hat on many sticks can be a particular sticking point. Your thumb is at a disadvantage when it comes to moving that hat side to side. These replacements improve the tactile response and grip so that your thumb can actuate the…
Overview I created this model after wanting to dry some filament on the cheap and not finding any way to get a Severin OD2940 or Elite Gourmet EFD319 which are covered extensively by this OG model by @SJB4127 . The model that is readily…
My own personal pocket organizer. My first version was manually crafted, v2 was 3 separate 3d prints glued to a styrene board, and this is v3: My EDC essentials on a pocket friendly board. I need my multi tool, key, and airpods every day…
I printed this device stand for the following devices, in order from non-pencil side of print to pencil side: iPad Pro 10.5in, 2018 (With Smart Keyboard) iPad, 6th Gen, (With Logitech Slim Folio Keyboard/case) MacBook Pro, 2018 Apple…
We love our Enso silicon rings ( ensorings.com ). We...have a few. So I made these boxes to hold them. The rings come in different widths; my wife likes the thinner ones, hence "ring box, women's". That one holds 26 rings, while the other…
Remix of https://www.thingiverse.com/thing:3329838/files by Frio. Removed the power switch and modified the front panel to accommodate a fused switch socket. The PSU bottom cap has also been modified for the increased depth of the switch.…
Bolt organising tray that holds your bolts, the relevant alan keys, and can measure the bolts if there is confusion. Recommended to print with variable layerheigt if you want to get the best result from the scale model. The print files…
Disclaimer: I had never used SolidWorks until a week ago, this fits my use-case currently - if you need to make adjustments feel free to improve on the design and tag me. Description: This is a microphone holder adapter for the…
1. Dedicated Design • Custom Fit: Unlike universal adapters, this system is modeled specifically to integrate with the router's under-table housing and the sliding fence. • Optimized Airflow: The internal geometry is designed to minimize…
Helps children change gear easier. Secured with three stainless steel M3 bolts and heat set threaded inserts. Feel free to use the included FreeCad model to change to any other type of fastenings. Printed with the "lid" flipped with the…
Adaptive pedal for Kinder King Kids Tricycle (Amazon link below) Designed for a tool-free perfect fit. Pedal and top bracket will need to be mirrored in slicer. Two adapters are required for each side. One adapter goes on upside down, one…
This is a highly optimized, fully parametric Compliant Helical Shaft Coupling designed specifically for 3D printing and precision mechanical engineering applications. Using an engineered helical flexure element, this component compensates…
Oral-B Braun toothbrush mount compatible with Danish power outlets. V02 has a tighter fit in outlet.
It is a 92mm fan duct adapter for the Cooler Master MasterLiquid 120L - IF the radiator is mounted in a non traditional placement, for example, on the side. I designed this adapter so the fan doesn't interfere with the heatsink of the…
this is the crown on my profile picture, i decided to model it because i was bored, also coz its a custom thing so i can make however i want, when ur assembling i used cyan-ish for the big gem/jewel thingie and red, green(supposed to be…
This box fits on the beam of the LowRider CNC v3, and fits the TFT35 e3 v3 and the SKR pro. This screen case fits on top nicely. https://www.printables.com/model/74330-tft35-e3-v3-case
This box fits on the beam of the LowRider CNC v3, and fits the 12864LCD and the Rambo. Here is the LCD box that pairs well with this. https://www.printables.com/model/20915-full-graphic-smart-controller-case
I wanted an air-assist nozzle that could be fitted / removed without any modification to the laser, plus maintaining the ortur magnetic shroud. Print Settings Printer Brand: Creality Printer: Ender 3 Rafts: Yes Supports: Yes Resolution:…
I'll be honest, I'd be amazed if anyone ever needs this! I have an odd use case of reusing an old mSATA SSD for my home server's boot drive and the hole spacing on it is totally wacky and doesn't fit anything. If you also bought one of…
I designed this tool to scribe cardboard boxes at 44mm height. This allows you to easily fold these cardboard boxes to a height of 46mm - 50mm. This has the advantage that I can cut many old boxes to the appropriate dimensions for a…
This is a simple camera modeled after a Canon professional camera, but not a specific one. I designed this using Tinkercad. Hopefully it works out with your printer. Thanks!
Wanted a barely visible way to mount my Savi's lightsaber to the wall. Will fit securely around the right "rings" on the hilt (see picture to position correctly. Basically, if you used the same pommel and the same upper guard as me,…
If you have the same flashlight (with integrated uv-light and laserpointer WOW!) then you can print this as a repairment. Just glue it in with some super glue and possibly trim off a bit of the beams and you're done!
Made this for my keyboard volume control. Maybe someone else could find a use for it. Anyway enjoy....
I bought inexpensive E3D-V5 nozzles from Amazon (B07WPK92PK) They were bagged and stuffed in a tiny plastic box - unacceptable I designed an index insert for the tiny disorganized plastic box. Now it is a tiny organized box, my OCD is…
Holds things and goes on a very thin (15.5mm) desk.
This mount is designed to be both the inner Y rail corner support and the Y motor mount. it bolts onto the inside of the two rear 20mm extrusions and the Y rail extrusion. The motor mounting screw locations are designed to be recessed. M3…
Added the f3d, maybe someone can solve their own very specific lamp situation with this. The 10mm holes are covered by printing one perimeter/layer and can easily be opened by using a cutter.
a toilet paper roll holder that fits a specific handle
Enter any specific celebratory text for the cute octopus to hold up with his handy-dandy party might!
I am asking for your help. If you see problems with this aggregation, then please leave me comments. If you think all is pretty good, then please click the “like” button or leave me comments as well. Thank you in advance. This is intended…
I had a missing C-clip for an airsoft gun so I hopped into CAD and designed one that would work. I printed it out and it works great! Please give feedback if not working correctly. MISSING PART; PRINT INSTRUCTIONS: INFILL: Doesn't matter…
The ‘sharplock side handle’ part of that balisong models has the problem which can occur the bad print quality at the bottom of the print result when go printing without any other post-processing. So I applied simple tricky way to make…
Securely attached squash ball feet. Creality Ender 3 S1 Pro only. (Ignore my non-touchscreen, this is S1 Pro) These screw on to the printer base, using the existing holes, and grip onto the existing rubber blocks. The feet are then…
Neat little storage box for Hemline sewing machine needles
35mm DIN Rail Mounting Fixed Buckle Snap Clip Clam for RPi4, Octopus, Mosfet, Solid State Relay, MeanWell 350, LED psu, Tobsun etc Needed 47.5mm hole distance, so made a few myself, or remixed, or borrowed Used this one for the BTT…
UPDATE 02/10/23: Included X/Y endstop piece for Widowmaker G1. UPDATE 19/09/23: Included new files for mounting a Goliath hotend along with the goliath duct and spacers. Also included a new BLTouch mount (it is too short by design, space…
Replacement part for a chair's foot, which were broken. The two small pins, which are printed as half objects, might need some sanding to fit nicely into their holes. Those pins are printed horizontally to increase their strength against…
This is a "remix" (not really, I made it from scratch, but imitating the original one) of the coin capsule tray for board game Ready Set Bet . My coin capsules were of the size 30mm, but that just means the inside are made to fit 30mm…
I made a bunch of removable boxes to fit in the long skinny drawers and organize lots of small hobby bits in my hobby desk space. Because the boxes are not much good without the drawers, and the drawers are not much good without the boxes…
This is a phone holder I designed to hold my Samsung z flip 4. It mounts on the front face of my mesh drawer monitor holder.
This is a remix of DennisP's excellent wall mounted key hanger you can find here: https://www.printables.com/model/151727-wall-mounted-key-hanger This version is specific to a bambulabs printer with AMS. I've colored it using black and…
This splits the eSun spool in 1/2 so that you can put remnants of spool together on one spool Print instructions Prints easy on MK3S
*** This is a remix of a y-axis camera mount I found on Thingiverse, but apparently the original make was delisted or Thingiverse is having a stroke as I can't find it on there anywhere, my file even shows the wrong remix link. I believe…
I made this model a while back because I needed something to organize the pile of random things under my monitor and I wanted to improve my Blender skills. You could technically put anything on the top shelf, but the bottom shelf has been…
Additional Summary With all the parts shown in the photos, this takes about 35 hours with a 0.8mm nozzle and layer heights of 0.6mm. I originally designed everything to be printed with a 0.4mm nozzle and layer heights of 0.3mm, but that…
My Steelseries Aerox 3 WL has been sliding around on the original stand so I created a bit less universal mouse pillar. I started from the ground-up again based on the measurings of the original STL.
My shower head keep moving. So After using tape, I designed this. It's a little too snug, I needed to trim the two grooves so it can fit. Print Settings Printer Brand: Creality Printer: Ender 3 Pro Rafts: No Supports: Yes Resolution: 0.2…
I thought my previous desk organizer was pretty specific to my needs, but recently decided I needed to out do that one. So now we've got this little fellow with the following features. Room for 3 pens, pencils, or anything else that fits…
I have remixed the rugged box to give a better functional purpose, specifically for electronic engineers who want to have electronic components in perfect order. The rugged box has 10 inserts and has the following dimensions: length…
I designed this part for a friend's whiteboard a while back, probably won't work for you.
Nahradni dil pro znameho k jejich vestavne skrini. Meli tam asi 6ks a z toho 5 z urvanou zachytnou packou. Bohuzel neni znam model skrine ci vyrobce daneho systemu ci pouziteho kovani. Jednalo se o 3-dverovou vestavnou skrin a tento dilek…
Really liked this box but since one of these will be storing nozzles for both the MK3.9 and XL I didn't need the printer model displayed. Also wanted a version without the V6 nozzle cutout since another one of the boxes will be storing…
Inspired by the talented design by jootoole ( https://www.thingiverse.com/thing:5214891 ). Made specifed for Breville/Saga Barista series, BES870, 872, 878, or other 54mm portafilters machines (not tested). 2 slots for portafilter. 2…
![Hat Switch Covers [Thumb Specific]](https://media.printables.com/media/prints/dced53c2-d400-40ea-9c47-a0b1302fb88a/images/11552427_e9870ec6-d405-4d4d-be4d-ac6daa781bab_4be3687d-f7d2-40fd-b95f-1005af23f0ec/thumbhats.png)
