1 / 13
Hexagon Twist Fidget - Print in Place
Zamów wydruk tego modelu
Obliczymy ostateczną cenę na podstawie wybranego pliku. Sprawdzisz ją i zaakceptujesz przed płatnością.
Zapisane na tym urządzeniu.
A Cool Hexagon Fidget. This fun toy is guaranteed to keep your hands busy. Prints in About 30 Min (Mini Version)
- Ocena
- 0 / 5
- Polubienia
- 11
- Pobrania
- 195
- Wydruki
- 0
- Wyświetlenia
- 435
- Oceny
- 0
Aktualizacja u źródła:
Informacje o modelu
- Źródło
- Printables
- Kategoria
- Other Toys & Games
- Licencja
- Creative Commons — Public Domain
SzczegółyPliki (3)Wydruki i komentarze (Wydruki: 0) (Komentarze: 0)Remiksy (0)Kolekcje (16)Powiązane
A highly tactile, pocket-sized geometric fidget toy designed for smooth twisting action and endless stress relief. Perfect for keeping your hands busy and looks amazing with silk or dual-color filaments!
Features
Smooth Mechanics: Satisfying interlocking geometric twist.
Print-in-Place: "Prints in one piece with no assembly!"
No Supports: Designed to print clean without any support material.
Recommended Print Settings
Layer Height: 0.2mm
Infill: 5%
Wall Loops: 2
Supports/Brim: None required
Tagi
hexagonalhexagontwistsmallringsfastfidgetfidgettoyfuneasytoprintflexibleflexiprintinplaceeasyfastprinttwistyeasyprintsimpleflexibletoyfidgeterstressrelieffidgetingillusionhexagonsstresstoysatisfyingfidgetdesktoyfidgettoyssmallprintstresslessadhdfidgethexagonfidgethexagonpatternstressrelieverfunfidgetfidgetshapefidgetfunminifidgetprintinplacefidgetfidgethexagonsuperfidgetstressfidgettwistyfidgethexagonfunminihexagonfidgeteasyfidgettwistysimplefidgetsimplefidgethexagonfidgetingfidgetadhd