Liczymy pasujące modele…
Great for teaching translation - 3D printed model of the 70S bacterial ribosome complete with mRNA, tRNAs and the emerging peptide chain. The two ribosomal subunits (large – violet and small – yellow) can be separated revealing the A,P…
This is a remake of the original Vortex Genie 2 Attachments by hisashin found on http://www.thingiverse.com/thing:3528209 . It will fit Eppi"s and 2 ml vials. Printed this and used it for the bead beating step in the DNeasy UltraClean…
The flagellar motor turns long corkscrew-shaped flagella at a speed of about 18,000 rpm allowing bacteria such as Salmonella to move. The flagellum needs to be anchored in the inner membrane and pass through the peptidoglycan and the…
The Green fluorescence protein (GFP) needs no introduction. This is a cartoon representation of the GFP with the chromatophore depicted as balls. I made this model for teaching protein folding, as this is great for showing beta-barrel. If…
Molecular surface representation of a nanopore (PDB ID 6si7 ) together with the bacteriophage phi29 DNA polymerase (PDB ID 1xhz ) and a piece of DNA. The nanopore and polymerase are sliced in half and have locations for magnets, while the…
A set of protein domains reading able to read DNA and interact with a specific nucleotide sequence. The set is great for explaining the role of the major groove in making the sequence information available from a double-strand DNA…
Model of yeast Phenylalanine transfer RNA from 1TRA.pdb in various representations. I made this to use it for teaching Biochemistry and Structural Biology. Segmentation Software : Cura (Any 3D slicer will work) 3D Modeling/CAD Software :…
Molecular surface representation of two antibodies interacting with the same antigen. PDB entries 1fdl and 1yqv were matched on the Y chain and then antibody structures from PDB entries 1igt and 1igy were matched with the Fab fragments…
Model of the B-DNA dodecamer from 1bna.pdb in a classical cartoon view. Great for discussing the helix. I made this to use it for teaching Biochemistry and Structural Biology. Print Settings Printer Brand: Creality Printer: Ender 5 Rafts:…
Model of the B-DNA dodecamer from 1bna.pdb as balls and sticks. The H bonds between base pairs are highlighted. Great for discussing the structure of nucleotides and DNA. I made this to use it for teaching Biochemistry and Structural…
Molecular surface representation of the bovine mitochondrial ATP synthase state 1b PDBID 5ARE. The chains were grouped and printed so that the main structural components are visible: F0 in green; F1 in blue; axle in red and stator in…
Surface model of a complex between the nucleosome core particle and a 146 bp long DNA fragment (PBD ID 1AOI). The DNA should be printed in flexible TPU while the histones core in rigid PLA. The flexible material allows for the DNA…
Model of the B-DNA dodecamer from 1bna.pdb as cartoon. The H bonds between base pairs are highlighted. Great for discussing the structure of nucleotides and DNA. I made this to use it for teaching Biochemistry and Structural Biology.…
Surface model of a complex between the T7 RNA polymerase, DNA, and RNA from PDBID:1MSW. Each chain (RNA, the two DNA strands, and the polymerase itself ) can be printed separately with different colors or materials. At least one of the…
Molecular surface representation of yeast proteasome from PDB 1FNT . Each of the components (alpha in green, beta in blue, and caps in red) were rendered separately and printed in different colored PLA. The beta catalytic domain was…
An alpha-helix from 2HHB.pdb containing aminoacids 1VLSPADKTNVKAAWGKVGA19, chain A, visualized as cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made this to use it for teaching…
Chaperonins assist the essential process of protein folding. These models depict the bacterial GroEL/GroES chaperonin as depicted in Figure 4-30B from Lehninger Principles of Biochemistry, Fifth Edition. A multi-material capable printer…
My Acerbis Koerta motorcycle body armor was missing a few pins. I used NUT JOB | Nut, Bolt, Washer and Threaded Rod Factory and a caliper and designed a replacement. Printed in PETG, then I used some heat to melt the top of the bolt to…
An alpha-helix from 2HHB.pdb containing aminoacids 1VLSPADKTNVKAAWGKVGA19, chain A, visualized as balls and sticks. Stabilizing H-bonds are visible. I made this to use it for teaching Biochemistry and Structural Biology. The plan is to…
The GABAA receptor is a crucial protein in the human brain that facilitates inhibitory neurotransmission, primarily by mediating the effects of the neurotransmitter GABA. It is a ligand-gated ion channel, meaning it opens in response to…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. I made this to use…
A DNA molecule Voronoi style that can serve as a nice decoration in any bio-molecular lab or office. Its based directly on PDB data and it is not enhanced in any way for better printability. I have successfully printed at 150x and 200x in…
Students use structural data available in PDB (Protein Data Bank) to design, print, and paint models of a DNA molecule and 3 protein domains that interact with DNA.
As part of their pathogenic strategy, Salmonella bacteria inject several dozen types of effector proteins using a molecular needle - the injectisome. These injected proteins disable the cell’s defenses and rewire the cell’s metabolism to…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are…
The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are…
An adapter for shaking standard, 96-well flat-bottom microplates on any GFL shaker. It should work with any 96-well plates and any shaker that allow fixing the adapter with 4 mm screws.
The ribosome is the universal molecular machine responsible for protein synthesis in all living cells. It reads the genetic code carried by messenger RNA (mRNA) and, with the help of transfer RNA (tRNA), assembles amino acids into a…
Ferritin is composed of 24 identical protein subunits that form a hollow shell. Iron ions can enter the inside chamber of ferritin through narrow pores. There is room to pack about 4500 iron ions inside the ferritin chamber. The…
T4-Lysozyme from 1LYD atomic coordinates visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms are highlighted. This is useful to show how secondary structures are arranged in 3D to form the tertiary structure of…
Model of the catalytic domain from the Trichoderma reesei cellulase highlighting the long groove that is form-fitted to bind to the cellulose chain. Protein was rendered as surface, then sliced in half to expose the binding groove.…
I need to take OD from bacterial cultures grown on microplates, but with the available black microplate adapter for my Tristar2 Multimode Reader LB942 the leads of the plates were always scratched and measurements were not reliable.…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted. Sidechains…
Surface model of lactate dehydrogenase (PDB ID 3LDH) showing the binding sites for NADH. Two models are provided: one for the complete homotetramer with 3 NAD's in place and one NAD binding site free; the second model is for a single…
Model of the B-DNA dodecamer from 1bna.pdb as surface, Great for showing the major and minor groove. I made this to use it for teaching Biochemistry and Structural Biology. Print Settings Printer Brand: Creality Printer: Ender 5 Rafts:…
Surface model of a stereospecific enzyme: 6-hydroxy-L-nicotine oxidase from Paenarrthrobacter nicotinovorans. The model was sliced in half in order to make the binding sites for FAD and substrates (6 hydroxy L- nicotine and 6 hydroxy D-…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as surface. I made this to use it for teaching Biochemistry and Structural Biology. Protein Data Bank ID:…
Model of the B-DNA dodecamer from 1bna.pdb as surface, Great for showing the major and minor groove. I made this to use it for teaching Biochemistry and Structural Biology Print Settings Printer Brand: Creality Printer: Ender 5 Rafts:…
T4 lysozyme is an enzyme that helps break down bacterial cell walls — a classic protein used to teach how structure relates to function. This model is designed for teaching protein tertiary structure, showing how different…
3DP-Jmol automatically generates 3D printable molecular models from macromolecules. It is useful for teachers and students for the fabrication of teaching material for bio-molecular sciences.
The AliExpress tail tidy is not compatible with the Westwind luggage rack . The turn signal hit the rack, so I designed some repositioning brackets. For better wire management, I have designed a cover over the tail tidy thing that also…
Aquaporins are membrane proteins that act as highly selective water channels, allowing water to move rapidly across biological membranes. In plants, they are essential for water balance and help cells respond to changing environmental…
To wszystkie aktualnie dostępne wyniki.
