P
Printablesdarcside
Perfect peptide box insert 26 3ml 5 10ml
Insert for my perfect peptide case. It holds 26 3ml and 5 10ml Print with 2 layer walls, 15% infill, preferably gyroid.
- Pobrania
- 174
- Polubienia
- 14
- Ocena
- 5
Wyniki wyszukiwania: peptide
Liczymy pasujące modele…
P
Printablesvidision
Peptide Vial Trays
A simple tray design to hold 3mL peptide vials. Smoothed surfaces for ergonomics — and features for vibration isolation and tip prevention! Shown here printed in TPU95A. The design is not specialized for 16.5mm diameter vials so it can be…
- Pobrania
- 136
- Polubienia
- 9
- Ocena
- 0
P
Printables
Peptide Vial Trays
A simple tray design to hold 3mL peptide vials. Smoothed surfaces for ergonomics — and features for vibration isolation and tip prevention! Shown here printed in TPU95A. The design is not specialized for 16.5mm diameter vials so it can be…
P
Printables
Peptide pen & needle holder
The original model fit a premade insulin pen. I changed this to fit common research peptide pens such as the V1 and V2 and others. I get mine from thepeppen.com but there are many sources. Added a hole in the top to hold the spare cover…
P
Printables
Perfect-peptide-case-insert
3 walls 15% infill small disconnect left two corners layers 1-6 but have had no issues printing.
P
Printables
Vials case with different 1x3 gridfinity inserts for insulin, glues, peptides, beauty etc
2 different sized inserts for different vial sizes. I removed the square extrusions in the lid, it prints a tiny bit faster and is easier to fit foam into if you want to do that. See original model for the bottom half of the case, I…
P
Printables
Drew peptide storage box
Designed for Drew to hold 2 12ml vials with plenty of syringe and and alcohol wipe storage. This uses six M3x40mm screws to assemble.
P
Printables
Vial Drawing Assist fits all 0.5ml to 30ml+ Insulin / GLP-1 / TRT / Peptides
What is it? Built to pair with my " Magnetic Injection Assistant ", this securely holds medication vials inline and at the correct depth while drawing your meds into a syringe. How to use: Add your vial to the Carrier (now is also a good…
P
Printables
Peptide container v1 will post new version once done printing
First of all, the slots for the 10ml vial were a tad bit too big so they wiggled a little, not a big issue but not up to my standard. Second, the lid was too short to fit the 10ml vials, didnt close all the way. Lastly big issue was that…
P
Printables
Rugged Box for Vials of Peptides, K-Beauty, or GLP-1 Medicine
hello! This is a rugged box with an inserts to organize medicine vials like those used to hold compounded semaglutide, tirzepetide, retatrutide, peptides, K-beauty, TRT, Ozempic, Mounjaro, etc. It uses the Gridfinity system. It keeps your…
P
Printables
3x5x5 Gridfinity Insert for 28 25mm 10ml Vials for Peptides or GLP's
3x5x5 Gridfinity insert that holds twenty eight 10ml vials, or anything else cylindrical that is smaller than 25mm This is used in a 3x5x9 Gridfinity box to hold 28 10mml vials. It has holes for magnets on the bottom. You can use it in a…
P
Printables
A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks
The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are…
P
Printables
The peptide backbone of an alpha helix from Hemoglobin as balls and sticks
An alpha-helix from 2HHB.pdb containing aminoacids 1VLSPADKTNVKAAWGKVGA19, chain A, visualized as balls and sticks. Stabilizing H-bonds are visible. I made this to use it for teaching Biochemistry and Structural Biology. The plan is to…
P
Printables
Peptide vial Organizers
Nothing special or complex just a vial organizer for the fridge to make vials stay where they should be. It can hold a 2 - 30 ml Bac Waters, 3 - 5ml, 5 - 3ml vials. I added a updated model that reflects more on actual usage experienced.…
P
Printables
Peptide vial Organizers
Nothing special or complex just a vial organizer for the fridge to make vials stay where they should be. It can hold a 2 - 30 ml Bac Waters, 3 - 5ml, 5 - 3ml vials. I added a updated model that reflects more on actual usage experienced.…
P
Printables
Rugged Insulin/Peptide Vial Box w/ Magnetic Lid
This is a simple box remix that holds 20ml vials in a high-density arrangement. The lid is secured with magnets. I did a simple scale of the 10 ml box so the 6x3 magnets may fit a little loose.
P
Printables
Insulin & Peptides Research Injection Pen Stand
I was looking for a good injection pen stand and was checking everywhere, what was available for printing, but felt like nothing was satisfying my interests. I wanted simple stand, that would hold majority of injection pens, will not flip…
P
Printables
Peptide Storage Tray - 3ml Vial
Yet another tray to use for storing peptides, or any 3ml vial, in your refrigerator. 8 staggered slots.
P
Printables
Peptide Storage Rack - 3mL
A tray for storing peptides that gives you quick access to each vial and an easy way identify the contents of each. 5 available slots total. Printed with and without supports and both seemed to work just fine but your mileage may of…
P
Printables
Peptide Vial Dust Cap - 3mL
Small dust caps to help keep your 3mL peptide vials free from dust and dirt while being stored.
P
Printables
Syringe Holder Peptides 1ML
this is a simple stand to keep in the fridge for loaded syringes for the next day. Holds two 1ML insulin syringes, i think i will make them stackable in the next rendition. Works great for the little Peptide station i have.
P
Printables
Peptide Vial Organizer Tray - 3/5/10/30mL Vials | Butter Drawer Size
Designed for the peptide enthusiast who needs organized, discreet fridge storage. This tray fits perfectly in the butter drawer of a standard refrigerator and holds a variety of common vial sizes — 3mL, 5mL, 10mL, and 30mL. Printed in two…
P
Printables
Peptide Vial Tray Set - Stackable 10mL Organizer | Two-Color Label
Modular peptide vial storage system designed for serious users. Includes two single-row trays — "The Stack" and "The Fountain of Youth" — each holding 10mL vials securely upright. Use them independently or together as a stackable system…
P
Printables
3ml vial peptide slide box
The most compact storage possible for 10 vials. No supports needed. Make the most of your freezer room. I got tired of the big boxes, so found an alternative.
P
Printables
Peptide pen & needle holder
The original model fit a premade insulin pen. I changed this to fit common research peptide pens such as the V1 and V2 and others. I get mine from thepeppen.com but there are many sources. Added a hole in the top to hold the spare cover…
P
Printables
Perfect-peptide-case-insert
3 walls 15% infill small disconnect left two corners layers 1-6 but have had no issues printing.
P
Printables
Vials case with different 1x3 gridfinity inserts for insulin, glues, peptides, beauty etc
2 different sized inserts for different vial sizes. I removed the square extrusions in the lid, it prints a tiny bit faster and is easier to fit foam into if you want to do that. See original model for the bottom half of the case, I…
P
Printables
Drew peptide storage box
Designed for Drew to hold 2 12ml vials with plenty of syringe and and alcohol wipe storage. This uses six M3x40mm screws to assemble.
P
Printables
Vial Drawing Assist fits all 0.5ml to 30ml+ Insulin / GLP-1 / TRT / Peptides
What is it? Built to pair with my " Magnetic Injection Assistant ", this securely holds medication vials inline and at the correct depth while drawing your meds into a syringe. How to use: Add your vial to the Carrier (now is also a good…
P
Printables
Vial Drawing Assist fits all 0.5ml to 30ml+ Insulin / GLP-1 / TRT / Peptides
What is it? Built to pair with my " Magnetic Injection Assistant ", this securely holds medication vials inline and at the correct depth while drawing your meds into a syringe. How to use: Add your vial to the Carrier (now is also a good…
P
Printables
Vial Drawing Assist fits all 0.5ml to 30ml+ Insulin / GLP-1 / TRT / Peptides
What is it? Built to pair with my " Magnetic Injection Assistant ", this securely holds medication vials inline and at the correct depth while drawing your meds into a syringe. How to use: Add your vial to the Carrier (now is also a good…
P
Printables
Peptide container v1 will post new version once done printing
First of all, the slots for the 10ml vial were a tad bit too big so they wiggled a little, not a big issue but not up to my standard. Second, the lid was too short to fit the 10ml vials, didnt close all the way. Lastly big issue was that…
P
Printables
Peptide pen kit rugged box
Rugged box made for a peptide pen plus needles and alcohol wipes
P
Printables
Peptide Rugged Case
Made this for my wife's peptides, couldn't find the original maker but modded it for my needs. Just throwing it out there to anyone who needs it.
P
Printables
Peptide Vial Organizer — 2-Row Remix (3× 10ml + 4× 3ml)
This is a remix of curmudgeon’s Peptide vial Organizer . The original holds three vial sizes (30ml bacteriostatic water, 5ml, and 3ml). I only needed the two smaller sizes, so I rebuilt the tray as a clean two-row version with a ~40%…
P
Printables
Peptide Pen & Needle Holder — 3-Pen Version
This is a remix of Peptide Pen Needle Holder by @Carlos_84806 . All credit for the original design — and especially the clever needle-tip retention slots — goes to them. What I changed: Holds 3 pens instead of 2. Larger pen bores (Ø20.6…
P
Printables
Peptide Pen & Tip Holder 6-Pen Grid Version (3x2)
This is a remix of Peptide Pen Needle Holder . What I changed (vs. the original 3-pen holder): Holds 6 pens in a 3x2 grid (3 across, 2 rows) on a 24 mm square pitch. Larger pen bores (Ø20.6 mm) so fatter auto-injector pens drop all the…
P
Printables
Peptide Medicine Vial Holder with Captive Lid
This holder is designed to hold peptide and medicine vials, such as healing peptides BPC-157. Has 3X ø.66" holes and 1X ø.70" hole made to suit my specific needs. Height from the bottom of the hole to the top of the lid is 1.82" I suggest…
P
Printables
Refrigerated Peptide/Insulin Syringe 2x a Day 1 Week Storage
I looked around and could not find a solution that met my needs so I hacked this together. I tried to use a couple other designs and even tried modifying them. In the end I just made a solution. This was printed on a x1c in draft mode .24…
P
Printables
Peptide 3ml Vials Rugged Box (Parametric)
This remix is to include cutouts to hold standard peptide vials for safe storage. You will need (6) - 3mm x 30mm bolts. I prefer to use stainless dowel pins: https://www.amazon.com/gp/product/B07YKZJB6Z
P
Printables
Peptide Vial Rack
A simple peptide vial rack to keep things organized while being refrigerated.
P
Printables
Rugged Insulin/Peptide Vial Box w/ Magnetic Lid
I created a simple box for holding 3ml and 10ml vials in a dense arrangement. Rather than using both with a hinge that could break, I opted to use 6x3 disc magnets, 4 per box, friction-fitted with the help of super glue. The design has 10…
P
Printables
Peptide Long Term Storage
When looking for a storage container, that seemed rugged for cold storage of my peptides it proved best to remix and come up with my own. If storing in the freezer, I would recommend using PETG as it is great down to about -40*. Hinges…