Liczymy pasujące modele…
Inspired by the Yoda bookend that holds leaning books up with the Force, minus the Yoda, and optimized for 3d printing. Place whatever fragile statue you want on the hex pad, and watch as your guests rush to save it only to look like…
Wydruk około 4,76 €–5,82 € nettoWstępna wycena jednego wariantu
The best Xbox controller stand is minimal and nearly invisible — keeping the focus on your controller, not the stand (🇦🇷 Designed in Argentina by @impuestito_org ) – THIS IS THE ORIGINAL DESIGN ✅ Minimal design. No supports needed. Weighs…
Modern Wall Hook with invisible mounting using a 3-4mm screw. Tested in PLA, PETG and Nylon. Three "top" variants are included: rounded, chamfered and sharp. Recommended settings: increase walls to 3-4, infill 35%+ Updated (2026/03/04):…
Hi there, this is a snap on two pieces wall hook Version 2 inspired by 3M command however following a no-support design. This one is designed to use with a 3M stick strip which can be bought separately. For those who likes the 3M stick…
Hey! I wanted a minimal and "invisible" stand to showcase my 8BitDo controller. So, I designed these little things. They're small but surprisingly stable. It fits into the screw holes on the bottom of the controller. Hope you enjoy it! Max
Plenty of invisible controller stands out there, but none for the Steam Controller (probably because nobody else has one), so I made one.
Hey my 3D-Friends! I have designed a easy wall mount for these ASUS-Routers: ASUS RT-BE96U ASUS ROG RAPTURE GT-BE98 ASUS ROG RAPTURE GT-BE98 PRO ASUS ROG RAPTURE GT-BE25000 ASUS ROG RAPTURE GT-BE19000 ASUS ROG RAPTURE GT-BE19000AI Here…
Rope clamp with invisible screws created by a cover to be clicked in. Print preferably in PETG to avoid wear by harsh weather condition. Example printed with PLA - works perfect. Easy print with raft 2mm and printing plate support.…
Invisible Wounds You Are Not Alone This was a user request. https://iwproject.org/ Give them some support if you can. Here is a shout out to all of those who have served, Thank You.
Solid version uses a lot of filament - 78 gram at 40% infill. And a lot of time too! - 2 hr and 15 min at 200 mm/s. So i created a lightened version for those who want to save time and filament. Lighter version only uses 43g and takes 1…
Affiliate links for my favorite filaments to help support what I do are here: Linktree A simple mount that cleanly display's your Ace of Spades nerf gun on the wall in either vertical or horizontal orientation. It inserts into the chamber…
Are you tired of the poor camera quality of the Creality Hi? Wish you could see your prints with clear resolution and night vision? I was frustrated with the camera quality of the stock camera in the Creality Hi, as are many others. I…
I printed this out of TPU with 3 walls, 8 top and bottom layers with 20% gyroid infill. There are two types of dimmers here to account for the presence of a screw head protruding from the behind the knobs. On my range, I needed one of the…
FR : support de spray mural , en deux partie pour que les vises ne soient pas apparentes. EN : Wall-mounted spray holder, in two parts so that the screws are not visible.
To be mounted with two 3mm flat screws (6mm head)
Summary Here you will find a slim, elegant, and ergonomic stand / riser for your Apple Magic Keyboard & Trackpad. The slight elevation at the back ensures fatigue-free typing during use. Optimized for fast print, less material consumption…
compact barely noticeable shoe holder that slides in between your shoes. ideally for size 10 mens or larger but can fit an 8 (barely).
NB : la description figure également en français sur l'Air du Bois Introduction I needed to mount two shelves in my bathroom after it was completely redone. The shelves are located between two walls and support little weight. However, I…
I originally designed this for a friend's wedding cake topper and printed in clear resin on a Form 2. Includes open and closed cockpit design - with or without stand.
Tomeks Hex Ukulele Hanger but with "invisible" mounting and a decorative pattern. Made with onshape
Modern Wall Hook with invisible mounting using a 3-4mm screw. Tested in PLA, PETG and Nylon. Three "top" variants are included: rounded, chamfered and sharp. Recommended settings: increase walls to 3-4, infill 35%+ Updated (2026/03/04):…
Impresora: Core One + Boquilla: 0,25 Altura de capa: 0,15 Relleno: Giroide 10% Paredes: 3 Material: ELEGOO Rapid PLA+
Modern wall hooks with invisible mounting using a 3-4mm screw. 3 differently sized fronts can be mounted to a single sized mount so you can easily switch and swap. Sizes Recommended settings: increase walls to 3-4, infill 35%+
🚀 WALL HOOK Invisible mounting. Modular design. Clean look. Tired of ugly wall hooks? This modular wall hook system hides the screw completely and lets you swap different front covers (sphere, hex, minimal) depending on your style. No…
Hey my 3D-Friends! I have designed a easy wall mount for these ASUS-Routers: ASUS RT-BE96U ASUS ROG RAPTURE GT-BE98 ASUS ROG RAPTURE GT-BE98 PRO ASUS ROG RAPTURE GT-BE25000 ASUS ROG RAPTURE GT-BE19000 ASUS ROG RAPTURE GT-BE19000AI Here…
I had the problem to easily close the inner slicing door after it is fully open. Thats why I designed a simple invisible handle to close the door. The handle is small enough to fit my fingers in between the handle and the cabinet. You can…
A clean photo frame designed so the date printed on your photo stays visible through a small window in the frame. The back plate locks in permanently using a pause-print technique — no screws, no glue, just resume printing and the plate…
I found existing models to be very bulky and not that elegant. I therefore created this wall mount for Lego Technic Cargo Plane 42025. The bracket is quick to print and does not use much material. When the plane is mounted, the wall mount…
I could not find any wall mount for the 9396 helicopter set. I therefore created this wall mount. The bracket is quick to print and does not use much material. When the helicopter is mounted, the wall mount nearly invisible. I used ABS…
These routing templates and clamp allow you to hide a MagSafe charger in a tabletop. Just use the templates to router the deep pocket for the charger and shallower areas for the clamp which is screwed in place. There are default templates…
Here I have three slightly different Cabinet Hanger inserts for you. New Hanger: GlueInPlace Instructions: First you need to drill a 20 mm wide and 9 mm deep hole to put them into. Then you push (or screw) in the Inserts. After that step…
Wallmount for mount camera to corner for wider visible range. You can see more then 180°. Fitting dimensions for camera: Holder is in 2 versions: 1. Complete one part. 2. holder divided to 2 parts and connected by M8 or M10 rood.
Never waste time searching for the right hex key again! Our organizer features clear sizes on one side for easy identification. Designed to accommodate keys of various sizes, from 4mm to 1.5mm. We recommend printing with flexible TPU…
3 little keychains with style :) Tag chavant_fou_3d if you ever post your make on instagram :) 0.2mm nozzle is best but it was printed with 0.4mm nozzle. Please take care to enable "fill between gaps" on your slicer. You will have to…
This is a really simple print that uses some mid print M3 Nuts and two 10mm M3 bolts to firmly secure “The Milky Way” Lego set to the wall. Most of the weight is held by the main body of the print where it juts out, distributing the…
A nearly invisible wall mount for the Home Assistant Green. Replace the screws with 25mm long M3 countersunk screws.
This model let your friends or colleagues assume, that you have a colt laying on your desk which is hidden by a piece of cotton. Could also be a decoration for the coming halloween. You could also call it fake-pistol, because there is…
Adapter for Insta360 ONE R and ONE RS cameras to always maintain the selfie stick in the camera's blinspot. Hole for ¼ inch threaded insert.
Scale to the size you want (original is 30 mm in diameter) print the two halves, and the middle sphere. click into place using hands or pliers.
You can switch side by using a Slicer to mirror it. Batteries are visible for awareness when they are running low. Optionally the plate can be used to cover both sides as well. Designed for a utility room or garage. Category: Organization
Print instructions 0,08mm layer heigh Printed in PLA or PETG, but any material should do Print front side down or back side like a foto No supports needed 15% infill 3 perimeters Additional hardware needed 2x 3,5x12 screws (or longer)
Invisible disability bow keychain and a badge for clothes and bags.
Are you a fan of Captain America and his iconic shield? Do you want to display your shield in a cool and secure way? Then you need the Captain America Shield Invisible Wall Mount , a 3D printable model that lets you hang your shield on…
Mount your records This is a pretty basic invisible vinyl record wall mount. Just insert one magnet in the print and the other one right above the print so that they are attracting each other. Then push the record and the magnet into each…
This silica gel container is inserted into the spool of filament. It is not screwed on. It can be easily replaced with one hand. (fig.1) The color of the silica gel can be seen at a glance. (fig.3) The size is as shown in the figure.…
Das ist ein Remix für 4mm Acrylscheiben (Türen und seitlich) Rückseite eine 15mm HDF Platte Rücksprung hintere Befestigung ist 18 mm so das auch eine etwas dickere Platte nicht übersteht Alle Teile müssen auch gespiegelt gedruckt werden…
Es como una mini caja (ni 10 minutos de imprimirlo) en la que cuando desplazas la tapa para abrirlo ves el nombre. He dejado los archivos de fusión y las tarjetas en blanco para que lo hagáis vosotros mismos y algunos nombres que tenía ya…
I ended up with 2 Skadis panel slightly twisted, and after mounting them side by side on the wall, I was annoyed with the result, as you can see in the picture. This connector allows you to connect 2 Ikea Skadis side by side using the…
To install, simply screw the mount onto your wall, align the notch with the cutout at the back of the knob and push it onto the mount. Rotate about a quarter turn to the right and you're done! Recommended print settings Use a 'quality' or…
Met deze afdruk kan je je boeken op een bijna onzichtbare plank stapelen. Je kan de onzichtbare boekensteun aan de muur vijzen en zo dan je boeken op stapelen. Het is de bedoeling dat je van het onderste boek de kaft onderaan de steun in…
Based on Fantastic 4 character fanart. Supports suggested. Powered by Image-to-3D from MakerWorld (https://makerworld.com/makerlab/imageTo3d)
2-pieces with the seat as an option. Stands up with or without. Supports required! Marvel Rivals. Powered by Image-to-3D from MakerWorld (https://makerworld.com/makerlab/imageTo3d)
This custom-designed hidden shelf is made specifically for the Ferrari SF-24 model by Burago (1:43 scale). It provides a sleek, invisible display solution by securely mounting to the wall with double-sided tape, eliminating the need for…
A version of the Xbox Controller Invisible Stand for the Joy-Con comfort grip.
Solid version uses a lot of filament - 78 gram at 40% infill. And a lot of time too! - 2 hr and 15 min at 200 mm/s. So i created a lightened version for those who want to save time and filament. Lighter version only uses 43g and takes 1…
Das Schlüsselbrett besteht aus zwei Elementen: Schlüsselbrett Der sichtbare Teil zum Aufhängen der Schlüssel. Benötigt eine Stützgeometrie an der Unterseite, die jedoch gut entfernt werden kann. Die Haken selbst können ohne Stützgeometrie…
Print Orientation! Front of the hook on to the bed! Update: Please reprint the base with the V2 stl file. There was an issue with the tolerances. Thank you @ Wojciech Kawa for pointing this out :)
These are two separate “feet” to hold a set of headphones in a standing position. I made these because I needed an (as far as possible) “invisible” stand for product photos of a series of headphones. Since the feet are not connected to…
Invisible low profile wall mount to let directly attach the sound system.
Upgrade your ( Hornbach) Soluna 50mm wooden blinds with this simple and effective servo mount for automated tilt control. Unlike setups that require stepper motors and controllers , this design leverages a widely available mini hobby…
The Invisible Sun Black Cube by Monte Cook Games is an amazing product, but for such a voluminous thing it wastes a lot of space. This insert was designed in order to fit all components for the game, all sleeved cards including the…
Invisible Joker card from Balatro Background is only 1 layer thick, looks more transparent in person. Swap white for clear filament if you have. All credit to LocalThunk and Balatro for the design
Wall mount that handle with tape for your Philips Hue Bridge.
I bought the "high quality" ChaoticLab CNC Door Mounting Kit for Voron 2.4 for a lot of money, but it did not fit into the recommended standard original Misumi 2020 Profiles for Voron printers. The profile is 1mm deeper than what the…
I've been using AcuRite 06044M sensors with home assistant and wanted to wall mount them, but the options I could find seemed more complex than what I wanted. This model is small, prints quickly, and hides behind the sensor once installed…
Minimalist invisible xbox one controller stand to be used with gridfinity system utilizing a 4x1 size
A nice design Clothes hook, made so the screws are not visual when mounted.
A bracket that snaps to the car's back piece, making it completely invisible. Hang it using so,e 12mm double-sided adhesive or one to three screws or nails.
An alpha-helix from 2HHB.pdb containing aminoacids 1VLSPADKTNVKAAWGKVGA19, chain A, visualized as cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made this to use it for teaching…
A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are…
Simple Anti-Slip Foot for the Creality K1, K1C, and K1 Max Printer This practical and discreet anti-slip foot is specifically designed to keep your Creality K1, K1C, and K1 Max printer stable. Thanks to its smart yet simple design, the…
I wanted to mount my ugreen usb switch in way, the status led is still visible. The desk has a thickness of 26mm, thinner desks work as well. The remote can be mounted with a bracked from another user, also available here, to the front of…
Magnetka v designu známé herní série The Last of Us . Vlastní výroby. Model s vloženým magnetem ("neviditelný magnet"). Vložení neodymového magnetu o průměru 1 cm a výšce cca 2 mm. (Při změně velikosti se změní i velikost magnetu.) Barva:…
This is a proof of concept for a minimally invasive (but rock-stable), modular/parametric system to attach stuff to wood boards. It's using two hidden dowel pins secured with 3mm SPAX wood screws. I'm planning to use this in my campervan,…
invisible ink pen and inkwell. just fill the inkwell with lemon juice and write You can find all my models here , thank you who will appreciate with a download or with a like
I want a “more stylish" model than the Original, so i made it wider with a slight curve on the both side. And to take more than a coat, I changed the angle to from 30° to 30° For printing settings, the same as the Original : - 4 Walls…
Description : This remix is a shorter version of the original modern hook, designed specifically to fit under tight spaces like closet shelves or cabinets. I love the original design, but wanted something that would fit in my hall closet…
This is a stand intended for coin photography. It is designed to be as “invisible” as possible; When taken from a front-on angle, it should be mostly hidden by the coin itself. I recommend printing it with the same color filament as the…
Affiliate links for my favorite filaments to help support what I do are here: Linktree A simple mount that cleanly display's your Ace of Spades nerf gun on the wall in either vertical or horizontal orientation. It inserts into the chamber…
____________________THIS IS DIGITAL PRODUCT___________________ ______________________NON-REFUNDABLE_______________________ ___________________STL FILES FOR 3D PRINTING___________________ Files to print Invisible Woman Malice skin cosplay…
magnetic holder that utilises the empty spaces left and/or right the “seat belt reminder display”. It isn't necessary to modify any original parts as the magnet holder drops in with some additional force. The magnetholder can be mirrored…
A simple design to secure a Sonoff SNZB-02D Zigbee sensor to your Multiboard setup using a Flush snap. Use the magnetic support included with the sensor and attach it to the printed part with the provided double-sided tape. Ensure the…
Print Orientation! Front of the hook on to the bed! Tested in PLA CLUB: Early Access to Invisible Wall Hook Feedback and Suggestions
Are you tired of the poor camera quality of the Creality Hi? Wish you could see your prints with clear resolution and night vision? I was frustrated with the camera quality of the stock camera in the Creality Hi, as are many others. I…
At 2024 @TeachingTech invented a SpaceMouse buildable for $20 and evolved it to a much smaller version V2. His descriptions are valid for all joystick-driven designs and is a good starting-point to learn about building a SpaceMouse. While…
100x160mm sign, advertising ACME Invisible Paint, as seen in cartoons. Mesh and Solid models provided. The solid version might be an easier print. Best with color switch above 1mm, as with included gcode for the mesh version. Also see the…
Simple invisible ball chain connector. Suited for balls around 3.4 mm and span of 4.2 mm. Print in ASA (UV resistant) or PC, ABS, PETG. Avoid PLA - might break.
a phone amplifier which u can slot your phone into to increase the volume and sound quality of your phone speaker the slot can easily be changed to fit any phone size the speaker can fit on a build plate so does not need to be printed in…
This minimalist 'Invisible Cover' is a sleek, 3D-printed case designed for the Samsung Galaxy S24.
Minecraft Creeper textured with base. There isn't any properly textured creeper model out there, so here you go. Base is separated. Texture is visible in 3D print.
I got tired of buying the easy to loose stakes for my Gardena (Husqvarna) robot's fence wire, so I designed these. They print fast, I use 2 walls and 20% infill, .03 layer height. They dont need to look great, just need to be able to be…
Everyone has different ideas about what they want in a 3D Catan set. Credit goes to many before me who have done the creative modeling making these sets true works of art. Thingiverse is only letting me reference Dakanzla’s V2.0 magnetic…
Life size pelvis of the Visible Human Female that I segmented from a CT scan. Each innominate and the sacrum+coccyx were segmented separately (and solid) so they can be printed separately. The parts have high detail with identifiable…
Minimal and nearly invisible controller stand adapted for the 8BitDo Ultimate C2. Remix of the Xbox invisible stand by Lucas Romero .
By this time i didnt have a printed version, but when i had one, it will be updated!
