1 / 3
Dragon Scale Bowl
Order a print of this model
We calculate the final price from your selected file. You review and accept it before payment.
Saved on this device.
Fantasy Dragon Scale Bowl – a stylish 3D printed bowl inspired by dragon scales for decor and everyday use.
- Rating
- 5 / 5
- Likes
- 198
- Downloads
- 843
- Makes
- 4
- Views
- 2,080
- Reviews
- 5
Updated at source:
Model information
- Source
- Printables
- Category
- Living Room
- License
- Creative Commons — Public Domain
Fantasy Dragon Scale Bowl – a stylish 3D printed bowl inspired by dragon scales for decor and everyday use.
Tags
kitchendisplaytableorganizer3ddragonofficeholderdeskprintcontainercoincosplaynodecorinteriorgeometricvikingfantasygamerminiaturetabletopgiftscalebowlfruitmedievalgothicstoragetreasuredicewarhammerprintinplaceplaeasyhomeminimalistlabtraymodernpetgkeyprintingvasemodeprintablecandypatternpaintingsupports3dprinteasyprinttrinkettexturedhomedecordungeondecorativemythicaluniqueelegantsnacksnackbowlstylishscalesideacointraycatchalldicebowlbambukeybowlbambulabdragonscalemakerworldfantasydecorheroes3resinlook